Gene Bio Systems
Recombinant Lactobacillus plantarum UPF0756 membrane protein JDM1_1594 (JDM1_1594)
Recombinant Lactobacillus plantarum UPF0756 membrane protein JDM1_1594 (JDM1_1594)
SKU:CSB-CF510503LMT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus plantarum (strain JDM1)
Uniprot NO.:C6VQL6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESWLFLLAILVVAWLGKNQSLQIATVVVLLIKLIPNTSKLLTTIGQKGINWGVTVITVA ILIPIATGQIGFRDLWHAFKSPVGWIAVACGVLVSVLSFHGVGLLSATPEITVALVFGTI MGVVLLKGIAAGPIIAAGITYCIIQVLHLSLQ
Protein Names:Recommended name: UPF0756 membrane protein JDM1_1594
Gene Names:Ordered Locus Names:JDM1_1594
Expression Region:1-152
Sequence Info:full length protein
