Gene Bio Systems
Recombinant Lactobacillus plantarum Protein CrcB homolog 1(crcB1)
Recombinant Lactobacillus plantarum Protein CrcB homolog 1(crcB1)
SKU:CSB-CF806101LMS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Uniprot NO.:Q88ZT8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVLVGLAGAGAAVGALSRYGIMRLALPLNRWPLPIATLFINLTGALLLGWILTSSLPPN WQIFLGTGIMGGYTTFSTMINELVLLGRNHHQRVAWEYFGLSLVGGLVMVYLGTLI
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:lp_0213
Expression Region:1-116
Sequence Info:full length protein
