1 1

Gene Bio Systems

Recombinant Lactobacillus helveticus UPF0756 membrane protein lhv_0995 (lhv_0995)

Recombinant Lactobacillus helveticus UPF0756 membrane protein lhv_0995 (lhv_0995)

CSB-CF428605LLE

$2,091.60 CAD
$2,091.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus helveticus (strain DPC 4571)

Uniprot NO.:A8YUY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MESWLFLALVLVVALVGKNMSLIIATGVVMALKLIPFASKWLPVIQAKGINWGVTVISVA ILIPVATGQIGFKDLINTFKSPAGWIAILAGIAVAILSRYGVDQLAAVPQVTVALVLGTI IGVVVFKGVAAGPVIASGMTYLVITLFNLHF

Protein Names:Recommended name: UPF0756 membrane protein lhv_0995

Gene Names:Ordered Locus Names:lhv_0995

Expression Region:1-151

Sequence Info:full length protein

View full details