Gene Bio Systems
Recombinant Lactobacillus helveticus UPF0756 membrane protein lhv_0995 (lhv_0995)
Recombinant Lactobacillus helveticus UPF0756 membrane protein lhv_0995 (lhv_0995)
SKU:CSB-CF428605LLE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus helveticus (strain DPC 4571)
Uniprot NO.:A8YUY6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MESWLFLALVLVVALVGKNMSLIIATGVVMALKLIPFASKWLPVIQAKGINWGVTVISVA ILIPVATGQIGFKDLINTFKSPAGWIAILAGIAVAILSRYGVDQLAAVPQVTVALVLGTI IGVVVFKGVAAGPVIASGMTYLVITLFNLHF
Protein Names:Recommended name: UPF0756 membrane protein lhv_0995
Gene Names:Ordered Locus Names:lhv_0995
Expression Region:1-151
Sequence Info:full length protein
