Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922(LBA0922)

Recombinant Lactobacillus acidophilus UPF0397 protein LBA0922(LBA0922)

SKU:CSB-CF688803LME

Regular price $2,142.00 CAD
Regular price Sale price $2,142.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)

Uniprot NO.:Q5FKJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNTGLSVKKVVAIGIGSAIYVILARFTSIPTPIPNTNIELVFPFLAFFASIYGATVGFS VGFIGHALSDFIMYGQTWWSWVLATGILGWIIGLAYKRLDLKNGIFGLKQIILFNIVQII ANILAWIVVAPIGDIIIYSEPANKVFVQGISATISNGISILIIGTILLKAYASTKIKKGS LRKED

Protein Names:Recommended name: UPF0397 protein LBA0922

Gene Names:Ordered Locus Names:LBA0922

Expression Region:1-185

Sequence Info:full length protein

View full details