Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus acidophilus Uncharacterized protein LBA1794(LBA1794)

Recombinant Lactobacillus acidophilus Uncharacterized protein LBA1794(LBA1794)

SKU:CSB-CF701961LME

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)

Uniprot NO.:Q5FI75

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSKDYESTEFYSYKFKNFSTMIIIPMALLVFILIIGSFFAIRQSTVTSTGIVEPQSTLD IANKNYHEGQIIKRNRSKWMVHLDDKKENIVHLLPIIKAKKSVNIVTYFPGNKIGAIKKG QPLHFQLSNANGTTDRLVGEVKEVGIYPVNLHGNNVYEVICKAKLDKDVKYGMEGNAPII TGKSTYFEYFKDKILN

Protein Names:Recommended name: Uncharacterized protein LBA1794

Gene Names:Ordered Locus Names:LBA1794

Expression Region:1-196

Sequence Info:full length protein

View full details