Gene Bio Systems
Recombinant Lactobacillus acidophilus Protein CrcB homolog 1(crcB1)
Recombinant Lactobacillus acidophilus Protein CrcB homolog 1(crcB1)
SKU:CSB-CF704982LME
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Uniprot NO.:Q5FKD2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTKTGNYISIAIFAFFGGIARAWLNSSFGFYGTFWGNIIGCFLLAFFTYLFMEFKDVRQ WLTVGLGTGFVGAFTTFSTFNLDVLKNIQANVPITALIYFLSSIIFGFCFAYLGMNAGKQ VGNLLRKED
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:LBA0992
Expression Region:1-129
Sequence Info:full length protein
