GeneBio Systems
Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a
Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a
SKU:P60979
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P60979
Gene Names: N/A
Alternative Name(s): Omega-FLTX-Kh1a;Toxin DW13.3
Abbreviation: Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a protein
Organism: Kukulcania hibernalis (Southern house spider) (Filistata hibernalis)
Source: E.coli
Expression Region: 1-74aa
Protein Length: Full Length
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: AECLMIGDTSCVPRLGRRCCYGAWCYCDQQLSCRRVGRKRECGWVEVNCKCGWSWSQRIDDWRADYSCKCPEDQ
MW: 15.6 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Potently blocks vertebrate calcium channels Cav1 and Cav2. Is the most active on Cav2.2/CACNA1B (from HEK) (IC(50)=2.3 nM), followed by Cav2.1/CACNA1A (IC(50)=4.3 nM), Cav2.2/CACNA1B (from oocyte) (IC(50)=14.4 nM), Cav1.2/CACNA1C (IC(50)=26.8 nM), and Cav2.3/CACNA1E (IC(50)=96.4 nM).
Reference:
Function:
