Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella pneumoniae UPF0114 protein KPK_0696 (KPK_0696)

Recombinant Klebsiella pneumoniae UPF0114 protein KPK_0696 (KPK_0696)

SKU:CSB-CF481025KBH

Regular price $2,111.20 CAD
Regular price Sale price $2,111.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae (strain 342)

Uniprot NO.:B5XU71

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFLENAMYTSRWLLAPVYFGLSLGLVALTIKFFQEIVHVLPHIFSVSESELILTLLSL VDMTLVGGLLVMVMFSGYENFVSQLDINEGKEKLSWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLNKVKH

Protein Names:Recommended name: UPF0114 protein KPK_0696

Gene Names:Ordered Locus Names:KPK_0696

Expression Region:1-164

Sequence Info:full length protein

View full details