Gene Bio Systems
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0442 protein KPN78578_47350 (KPN78578_47350)
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0442 protein KPN78578_47350 (KPN78578_47350)
SKU:CSB-CF408512KAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Uniprot NO.:A6THX5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIISFIFALAEDMLLAAIPAVGFAMVFNVPQRALRWCALLGAIGHGSRMIMMSAGFNIE WATFLAALLVGSIGIQWSRWYLAHPKIFTVAAVIPMFPGISAYTAMISAVKISHFGYSEE MMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV
Protein Names:Recommended name: UPF0442 protein KPN78578_47350
Gene Names:Ordered Locus Names:KPN78578_47350 ORF Names:KPN_04813
Expression Region:1-157
Sequence Info:full length protein
