Gene Bio Systems
Recombinant Klebsiella pneumoniae subsp. pneumoniae NADH-quinone oxidoreductase subunit A(nuoA)
Recombinant Klebsiella pneumoniae subsp. pneumoniae NADH-quinone oxidoreductase subunit A(nuoA)
SKU:CSB-CF411678KAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Uniprot NO.:A6TBX4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRMSTSTEVIAHHWAFAIFLIIAIGLCCLMLVGGWYLGGRARARSKNTPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRI GALDWTPARSRRTLVNPETDSPTNRHMQ
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:KPN78578_26340 ORF Names:KPN_02678
Expression Region:1-148
Sequence Info:full length protein
