>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Microbiology
Target / Protein: mrkA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Klebsiella pneumoniae
Delivery time: 3-7 business days
Uniprot ID: P12267
AA Sequence: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 23-202aa
Protein length: Full length of Mature Protein
MW: 34.5 kDa
Alternative Name(s):
Relevance:
Reference: "Molecular characterization of the type 3 (MR/K) fimbriae of Klebsiella pneumoniae."Gerlach G.-F., Allen B.L., Clegg S.J. Bacteriol. 170:3547-3553(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.