Gene Bio Systems
Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)
Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)
SKU:CSB-CF408880KAW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Uniprot NO.:A6WCN9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDVLRSIALFVLAALLEIGGAWLVWQGVREHRGLAWIGAGVIALGLYGFAATLQPEAQFG RVLAAYGGVFVAGSLLWAAVVDGYRPDRFDVAGALVCLVGVGIVMYAPRPS
Protein Names:Recommended name: UPF0060 membrane protein Krad_3114
Gene Names:Ordered Locus Names:Krad_3114
Expression Region:1-111
Sequence Info:full length protein
