1 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 6 Transmembrane protein 049L(IIV6-049L)

Recombinant Invertebrate iridescent virus 6 Transmembrane protein 049L(IIV6-049L)

CSB-CF852758INA

$2,051.00 CAD
$2,051.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Uniprot NO.:Q91G50

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MDKIEELKIEELKIEIPQRKTKFFHDSENSDKRDEEETLNPTITSKAKILIKSKNFWIET LIFVISVFGALCVAFGIMLIGFLLWLVSNTISILYFIKQKQYPLSLQQMVFLITTCIGVY NNV

Protein Names:Recommended name: Transmembrane protein 049L

Gene Names:ORF Names:IIV6-049L

Expression Region:1-123

Sequence Info:full length protein

View full details