Gene Bio Systems
Recombinant Invertebrate iridescent virus 6 Transmembrane protein 049L(IIV6-049L)
Recombinant Invertebrate iridescent virus 6 Transmembrane protein 049L(IIV6-049L)
SKU:CSB-CF852758INA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Uniprot NO.:Q91G50
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MDKIEELKIEELKIEIPQRKTKFFHDSENSDKRDEEETLNPTITSKAKILIKSKNFWIET LIFVISVFGALCVAFGIMLIGFLLWLVSNTISILYFIKQKQYPLSLQQMVFLITTCIGVY NNV
Protein Names:Recommended name: Transmembrane protein 049L
Gene Names:ORF Names:IIV6-049L
Expression Region:1-123
Sequence Info:full length protein
