Gene Bio Systems
Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R(IIV3-112R)
Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R(IIV3-112R)
SKU:CSB-CF619300IAAL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Uniprot NO.:Q196U8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRQVTPIYPRTNGTIQPVNFPIRNMEPPNHSLQSAGFQIPPPDAQFPRYHAAAPHHPRV EAAAPSCLDVARHVESCPICSRIHDTDKTLYVLVIVGLTILCFLLVKRILKL
Protein Names:Recommended name: Uncharacterized protein 112R
Gene Names:ORF Names:IIV3-112R
Expression Region:1-112
Sequence Info:full length protein
