Gene Bio Systems
Recombinant Inner membrane protein yjcH(yjcH)
Recombinant Inner membrane protein yjcH(yjcH)
SKU:CSB-CF360221SZB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P0AF55
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS VTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
Protein Names:Recommended name: Inner membrane protein yjcH
Gene Names:Name:yjcH Ordered Locus Names:SF4128, S3595
Expression Region:1-104
Sequence Info:full length protein
