Gene Bio Systems
Recombinant Influenza B virus Glycoprotein NB(NB)
Recombinant Influenza B virus Glycoprotein NB(NB)
SKU:CSB-CF324527IJY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Influenza B virus (strain B/Victoria/3/1985)
Uniprot NO.:P16208
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFTKNNCTNNDIGLHERIK CSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN
Protein Names:Recommended name: Glycoprotein NB
Gene Names:Name:NB
Expression Region:1-99
Sequence Info:full length protein
