Gene Bio Systems
Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7(ORF7)
Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7(ORF7)
SKU:CSB-CF309162IAD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)
Uniprot NO.:Q00133
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAVILERAAEFVAPGEARVGYPILAEVYRALTSDHEMRAFYETCAVSFFALFMLIIWVL HASRHPEGSTTRGTDAHTQTEGSTTRGTDAHTQTEGSRDQGSMTPEADDLTRPPLGHGRQ IPVLRRRMVLDRDLRIDYSL
Protein Names:Recommended name: Putative membrane protein ORF7
Gene Names:Name:ORF7
Expression Region:1-140
Sequence Info:full length protein
