Recombinant Hymenolepis diminuta Dihydrolipoyl dehydrogenase

SKU: P80647

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Biochemicals

Uniprot ID: P80647

Gene Names: N/A

Alternative Name(s): Dihydrolipoamide dehydrogenase

Abbreviation: Recombinant Hymenolepis diminuta Dihydrolipoyl dehydrogenase protein

Organism: Hymenolepis diminuta (Rat tapeworm)

Source: E.coli

Expression Region: 1-53aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: LSSGEKDLVVIGSGPGGYVAAIKAAQLGMLTVCIEKYPTFGGTCLNVGCIPSK

MW: 10.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Lipoamide dehydrogenase is a component of the glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes (By similarity). This enzyme has lipoamide dehydrogenase activity and NADH -> NAD transhydrogenation activity. Also displays some NADH-ferricyanide reductase and NADPH -> NAD transydrogenation activities.

Reference: "Hymenolepis diminuta: mitochondrial NADH --> NAD transhydrogenation and the lipoamide dehydrogenase system." Walker D.J., Burkhart W., Fioravanti C.F. Exp. Parasitol. 85: 158-167(1997)

Function: