Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hydrogenase-4 component E(hyfE)

Recombinant Hydrogenase-4 component E(hyfE)

SKU:CSB-CF360176EOD

Regular price $2,188.20 CAD
Regular price Sale price $2,188.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AEW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Protein Names:Recommended name: Hydrogenase-4 component E EC= 1.-.-.-

Gene Names:Name:hyfE Ordered Locus Names:Z3745, ECs3347

Expression Region:1-216

Sequence Info:full length protein

View full details