
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: Q9NY26
Gene Names: SLC39A1
Organism: Homo sapiens (Human)
AA Sequence: MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
Expression Region: 126-179aa
Sequence Info: Cytoplasmic Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 9.6 kDa
Alternative Name(s): Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1 ;ZIP-1 ;hZIP1
Relevance: Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
Reference: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.