Recombinant Human Zinc finger protein GLI2(GLI2),partial

SKU: CSB-EP009500HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P10070

Gene Names: GLI2

Organism: Homo sapiens (Human)

AA Sequence: EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Expression Region: 412-641aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 42.5 kDa

Alternative Name(s): GLI family zinc finger protein 2 Tax helper protein

Relevance: Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856).

Reference: "Novel heterozygous nonsense GLI2 mutations in patients with hypopituitarism and ectopic posterior pituitary lobe without holoprosencephaly."Franca M.M., Jorge A.A., Carvalho L.R., Costalonga E.F., Vasques G.A., Leite C.C., Mendonca B.B., Arnhold I.J.J. Clin. Endocrinol. Metab. 95:E384-E391(2010) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.