Gene Bio Systems
Recombinant Human Vesicle-associated membrane protein 5(VAMP5)
Recombinant Human Vesicle-associated membrane protein 5(VAMP5)
SKU:CSB-CF025784HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95183
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Protein Names:Recommended name: Vesicle-associated membrane protein 5 Short name= VAMP-5 Alternative name(s): Myobrevin
Gene Names:Name:VAMP5 ORF Names:HSPC191
Expression Region:1-116
Sequence Info:full length protein
