Recombinant Human Versican core protein(VCAN),partial

Recombinant Human Versican core protein(VCAN),partial

CSB-BP025810HU(A5)
Regular price
$585.70 CAD
Sale price
$585.70 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Signal Transduction

Uniprot ID: P13611

Gene Names: VCAN

Organism: Homo sapiens (Human)

AA Sequence: GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Expression Region: 3089-3354aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 34.6 kDa

Alternative Name(s): Chondroitin sulfate proteoglycan core protein 2

Relevance: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Reference: "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262(2014)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share