Recombinant Human Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU: CSB-CF675834HU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q3ZAQ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21 Alternative name(s): Myopathy with excessive autophagy protein

Gene Names:Name:VMA21 Synonyms:MEAX, XMEA

Expression Region:1-101

Sequence Info:full length protein