Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8NHE4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE
Protein Names:Recommended name: V-type proton ATPase subunit e 2 Short name= V-ATPase subunit e 2 Alternative name(s): Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2 Vacuolar proton pump subunit e 2
Gene Names:Name:ATP6V0E2 Synonyms:ATP6V0E2L, C7orf32
Expression Region:1-81
Sequence Info:full length protein