Gene Bio Systems
Recombinant Human Uncharacterized protein ZMYM6NB(ZMYM6NB)
Recombinant Human Uncharacterized protein ZMYM6NB(ZMYM6NB)
SKU:CSB-CF843325HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8NCS4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KLSEEISAPVSERMNALFVQFAEVFPLKVFGYQPDPLNYQIAVGFLELLAGLLLVMGPPM LQEISNLFLILLMMGAIFTLAALKESLSTCIPAIVCLGFLLLLNVGQLLAQTKKVVRPTR KKTLSTFKESWK
Protein Names:Recommended name: Uncharacterized protein ZMYM6NB Alternative name(s): ZMYM6 neighbor protein
Gene Names:Name:ZMYM6NB
Expression Region:23-154
Sequence Info:full length protein
