Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Uncharacterized membrane protein C3orf80(C3orf80)

Recombinant Human Uncharacterized membrane protein C3orf80(C3orf80)

SKU:CSB-CF518993HU

Regular price $2,182.60 CAD
Regular price Sale price $2,182.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:F5H4A9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RGGGGCAELACGERERCCDATNATAVRCCKLPLHAFLDNVGWFVRKLSGLLILLVLFAIG YFLQRIICPSPRRYPRGQARPGQRPGPPGGAGPLGGAGPPDDDDDSPALLRDEAAAGSQD SLLDSGGGGRGRGGGGRSDPSCASEHEMRVVSPVFLQLPSYEEVKYLPTYEESMRLQQLS PGEVVLPVSVLGRPRGGVAAEPDGGEGRYPLI

Protein Names:Recommended name: Uncharacterized membrane protein C3orf80

Gene Names:Name:C3orf80

Expression Region:36-247

Sequence Info:full length protein

View full details