Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

CSB-YP020067HU
Regular price
$855.36 CAD
Sale price
$855.36 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Neuroscience

Target / Protein: ROR1

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q01973

AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Tag info: N-terminal 6xHis-tagged

Expression Region: 30-391aa

Protein length: Extracellular Domain

MW: 42.6 kDa

Alternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1

Relevance: Tyrosine-protein kinase receptor whose role is not yet clear.

Reference: Human neural tissues express a truncated Ror1 receptor tyrosine kinase, lacking both Extracellular domain and transmembrane domains.Reddy U.R., Phatak S., Pleasure D.Oncogene 13:1555-1559(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share