Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P55327
Gene Names: TPD52
Organism: Homo sapiens (Human)
AA Sequence: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Expression Region: 1-184aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 35.9 kDa
Alternative Name(s): Protein N8
Relevance:
Reference: Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins.Wang R., He H., Sun X., Xu J., Marshall F.F., Zhau H., Chung L.W., Fu H., He D.Biochem. Biophys. Res. Commun. 389:455-460(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.