Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

SKU:P36941

Regular price $384.20 CAD
Regular price Sale price $384.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cell Biology

Uniprot ID: P36941

Gene Names: LTBR

Alternative Name(s): CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III

Abbreviation: Recombinant Human LTBR protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 31-227aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

MW: 23.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU) , the EC50 is 0.6450-0.8200 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 4.399-5.172 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2). Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Reference: Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36: 40-45 (2004)

Function:

View full details