Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

SKU:CSB-RP072244h

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: P19438

Gene Names: TNFRSF1A

Organism: Homo sapiens (Human)

AA Sequence: VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT

Expression Region: 31-210aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47.2 kDa

Alternative Name(s): Tumor necrosis factor receptor 1 ;TNF-R1Tumor necrosis factor receptor type I ;TNF-RI ;TNFR-Ip55p60; CD120a

Relevance: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

Reference: Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.Wang P., Yu P., Gao P., Shi T., Ma D.BMC Genomics 10:518-518(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details