Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor receptor superfamily member 13B(TNFRSF13B)

Recombinant Human Tumor necrosis factor receptor superfamily member 13B(TNFRSF13B)

SKU:CSB-CF023971HU

Regular price $2,301.60 CAD
Regular price Sale price $2,301.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14836

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 13B Alternative name(s): Transmembrane activator and CAML interactor CD_antigen= CD267

Gene Names:Name:TNFRSF13B Synonyms:TACI

Expression Region:1-293

Sequence Info:full length protein

View full details