Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein(TNFSF9),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein(TNFSF9),partial

CSB-RP080474h
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P41273

Gene Names: TNFSF9

Organism: Homo sapiens (Human)

AA Sequence: PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Expression Region: 52-254aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 25.3 kDa

Alternative Name(s): 4-1BB ligand receptorCDw137T-cell antigen 4-1BB homologT-cell antigen ILA; CD137

Relevance: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Reference: Molecular and biological characterization of human 4-1BB and its ligand.Alderson M.R., Smith C.A., Tough T.W., Davis-Smith T., Armitage R.J., Falk B., Roux E., Baker E., Sutherland G.R., Din W.S., Goodwin R.G.Eur. J. Immunol. 24:2219-2227(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share