Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active)

SKU:O95150-2

Regular price $584.80 CAD
Regular price Sale price $584.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: O95150-2

Gene Names: TNFSF15

Alternative Name(s): TL1, VEGI

Abbreviation: Recombinant Human TNFSF15 protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-192aa

Protein Length: Full Length of Isoform 2

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

MW: 24.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody(CSB-RA023992MA1HU). The EC50 is 0.8389-0.9731 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.

Reference: VEGI, a novel cytokine of the tumor necrosis factor family, is an angiogenesis inhibitor that suppresses the growth of colon carcinomas in vivo. Zhai Y., Ni J., Jiang G.-W., Lu J., Xing L., Lincoln C., Carter K.C., Janat F., Kozak D FASEB J. 13: 181-189 (1999)

Function:

View full details