Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P04155
Gene Names: TFF1
Organism: Homo sapiens (Human)
AA Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Expression Region: 25-84aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 8.7 kDa
Alternative Name(s): Breast cancer estrogen-inducible protein;PNR-2;Polypeptide P1.A ;hP1.AProtein pS2
Relevance: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Reference: Sequence of the pS2 mRNA induced by estrogen in the human breast cancer cell line MCF-7.Jakowlew S.B., Breathnach R., Jeltsch J.-M., Masiakowski P., Chambon P.Nucleic Acids Res. 12:2861-2878(1984)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.