Gene Bio Systems
Recombinant Human Transmembrane protein 50A(TMEM50A)
Recombinant Human Transmembrane protein 50A(TMEM50A)
SKU:CSB-CF023849HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95807
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACG VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYV AKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
Protein Names:Recommended name: Transmembrane protein 50A Alternative name(s): Small membrane protein 1
Gene Names:Name:TMEM50A Synonyms:SMP1 ORF Names:UNQ386/PRO718
Expression Region:1-157
Sequence Info:Full length protein
