Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane and ubiquitin-like domain-containing protein 1(TMUB1)

Recombinant Human Transmembrane and ubiquitin-like domain-containing protein 1(TMUB1)

SKU:CSB-CF861149HU

Regular price $2,233.00 CAD
Regular price Sale price $2,233.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BVT8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATD SMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAW PHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNP PCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA FAMYRP

Protein Names:Recommended name: Transmembrane and ubiquitin-like domain-containing protein 1 Alternative name(s): Hepatocyte odd protein shuttling protein Ubiquitin-like protein DULP Ubiquitin-like protein SB144

Gene Names:Name:TMUB1 Synonyms:C7orf21, DULP, HOPS ORF Names:SB144, UNQ763/PRO1555

Expression Region:1-246

Sequence Info:full length protein

View full details