
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cancer
Uniprot ID: P30408
Gene Names: TM4SF1
Organism: Homo sapiens (Human)
AA Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS
Expression Region: 115-161aa
Sequence Info: Extracellular Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 7.3 kDa
Alternative Name(s): Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6
Relevance:
Reference: "Cloning and expression of the tumor-associated antigen L6."Marken J.S., Schieven G.L., Hellstroem I., Hellstroem K.E., Aruffo A.Proc. Natl. Acad. Sci. U.S.A. 89:3503-3507(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.