Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Transcription regulator protein BACH2 (BACH2), partial

Recombinant Human Transcription regulator protein BACH2 (BACH2), partial

SKU:Q9BYV9

Regular price $982.60 CAD
Regular price Sale price $982.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: Q9BYV9

Gene Names: BACH2

Alternative Name(s): (BTB and CNC homolog 2)

Abbreviation: Recombinant Human BACH2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 618-770aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: PVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL

MW: 23.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Plays an important role in coordinating transcription activation and repression by MAFK. Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1. Positively regulates the nuclear import of actin. Is a key regulator of adaptive immunity, crucial for the maintenance of regulatory T-cell function and B-cell maturation.

Reference: "BACH2 immunodeficiency illustrates an association between super-enhancers and haploinsufficiency." Afzali B., Groenholm J., Vandrovcova J., O'Brien C., Sun H.W., Vanderleyden I., Davis F.P., Khoder A., Zhang Y., Hegazy A.N., Villarino A.V., Palmer I.W., Kaufman J., Watts N.R., Kazemian M., Kamenyeva O., Keith J., Sayed A. Laurence A.D.J. Nat. Immunol. 18: 813-823(2017)

Function:

View full details