Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase(DHDH)

Recombinant Human Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase(DHDH)

SKU:CSB-EP890780HU

Regular price $1,269.80 CAD
Regular price Sale price $1,269.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q9UQ10

Gene Names: DHDH

Organism: Homo sapiens (Human)

AA Sequence: MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Expression Region: 1-334aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 63.4 kDa

Alternative Name(s): D-xylose 1-dehydrogenase D-xylose-NADP dehydrogenase Dimeric dihydrodiol dehydrogenase Hum2DD

Relevance:

Reference: "Overexpression of dihydrodiol dehydrogenase as a prognostic marker in resected gastric cancer patients." Chang H.C., Chen Y.L., Chan C.P., Yeh K.T., Kuo S.J., Ko C.J., Fang H.Y. Dig. Dis. Sci. 54:342-347(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details