Gene Bio Systems
Recombinant Human Thioredoxin-like protein 4B(TXNL4B)
Recombinant Human Thioredoxin-like protein 4B(TXNL4B)
SKU:CSB-EP868342HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q9NX01
Gene Names: TXNL4B
Organism: Homo sapiens (Human)
AA Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Expression Region: 1-149aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 44 kDa
Alternative Name(s): Dim1-like protein
Relevance: Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.
Reference: "DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." Sun X., Zhang H., Wang D., Ma D., Shen Y., Shang Y. J. Biol. Chem. 279:32839-32847(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
