Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Taste receptor type 2 member 19(TAS2R19)

Recombinant Human Taste receptor type 2 member 19(TAS2R19)

SKU:CSB-CF023145HU

Regular price $2,311.40 CAD
Regular price Sale price $2,311.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P59542

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLW VMLFLWYATVFNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLH LKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVT TLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAI YFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR

Protein Names:Recommended name: Taste receptor type 2 member 19 Alternative name(s): Taste receptor type 2 member 23 Taste receptor type 2 member 48 Short name= T2R48

Gene Names:Name:TAS2R19 Synonyms:TAS2R23, TAS2R48

Expression Region:1-299

Sequence Info:Full length protein

View full details