Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human T-cell antigen CD7(CD7),partial (Active)

Recombinant Human T-cell antigen CD7(CD7),partial (Active)

SKU:CSB-MP004953HU

Regular price $520.00 CAD
Regular price Sale price $520.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:P09564

Uniprot Entry Name:

Gene Names:CD7

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:26-180aa

Sequence:AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Protein Description:Partial

Tag Info:C-terminal hFc-Myc-tagged

Mol. Weight:46.54

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 ?g/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml.?Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.

Purity:Greater than 94.5% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details