Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: O43759
Gene Names: SYNGR1
Organism: Homo sapiens (Human)
AA Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP
Expression Region: 1-191aa
Sequence Info: Full Length of Isoform 1B
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 48 kDa
Alternative Name(s):
Relevance: Involved in the regulation of short-term and long-term synaptic plasticity.
Reference: "Characterization of the human synaptogyrin gene family." Kedra D., Pan H.-Q., Seroussi E., Fransson I., Guilbaud C., Collins J.E., Dunham I., Blennow E., Roe B.A., Piehl F., Dumanski J.P. Hum. Genet. 103:131-141(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.