Recombinant Human SPARC(SPARC)

Recombinant Human SPARC(SPARC)

CSB-RP094444h
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P09486

Gene Names: SPARC

Organism: Homo sapiens (Human)

AA Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Expression Region: 18-303aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 59.7 kDa

Alternative Name(s): Basement-membrane protein 40 ;BM-40Osteonectin ;ONSecreted protein acidic and rich in cysteine

Relevance: Appears to regulate cell growth through interactions with the Extracellular domain matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell mbranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca2+ with a low affinity and an EF-hand loop that binds a Ca2+ ion with a high affinity.

Reference: "Structure of human osteonectin based upon analysis of cDNA and genomic sequences."Villarreal X.C., Mann K.G., Long G.L.Biochemistry 28:6483-6491(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share