Gene Bio Systems
Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1(ATP1B1)
Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1(ATP1B1)
SKU:CSB-CF002326HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P05026
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-1
Gene Names:Name:ATP1B1 Synonyms:ATP1B
Expression Region:1-303
Sequence Info:full length protein
