Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(NKAIN3)

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(NKAIN3)

SKU:CSB-CF854068HU

Regular price $2,160.20 CAD
Regular price Sale price $2,160.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N8D7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGCCTGRCSLICLCALQLVSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPR YIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLP PSAHGMMDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTYSC DLQVCKHLFIQMLQIIE

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 3 Alternative name(s): Protein FAM77D

Gene Names:Name:NKAIN3 Synonyms:FAM77D

Expression Region:1-197

Sequence Info:full length protein

View full details