Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 1(NKAIN1)

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 1(NKAIN1)

SKU:CSB-CF679664HU

Regular price $2,143.40 CAD
Regular price Sale price $2,143.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q4KMZ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIIC FYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLD YPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQ PLYTSG

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1 Alternative name(s): Protein FAM77C

Gene Names:Name:NKAIN1 Synonyms:FAM77C

Expression Region:22-207

Sequence Info:full length protein

View full details