Gene Bio Systems
Recombinant Human Sodium-glucose cotransporter 2(SLC5A2), partial
Recombinant Human Sodium-glucose cotransporter 2(SLC5A2), partial
SKU:CSB-EP021679HU1
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Signal Transduction
Target / Protein: SLC5A2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P31639
AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-102aa
Protein length: Partial
MW: 15.5 kDa
Alternative Name(s): Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Relevance: Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules
Reference: "Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes." Castaneda F., Burse A., Boland W., Kinne R.K. Int J Med Sci 4:131-139(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
