Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O95436
Gene Names: SLC34A2
Organism: Homo sapiens (Human)
AA Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Expression Region: 574-689aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 27.1 kDa
Alternative Name(s): Na(+)-dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B
Relevance: May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Reference: "Regulation of the human sodium-phosphate cotransporter NaPi-IIb gene promoter by epidermal growth factor." Xu H., Collins J.F., Bai L., Kiela P.R., Ghishan F.K. Am. J. Physiol. 280:C628-C636(2001)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.